Statistics

hediyelik kahve fincaný takÄ±mlarÄ± kÃ¼tahya gÃ¼ral porselen fincan ...

www.hediyelikkahvefincanitakimlari.com/

hediyelik kahve fincanÄ± takÄ±mlarÄ± kÃ¼tahya gÃ¼ral porselen fincan setleri,Ã§ini kahve takÄ±mÄ± Hediyelik Kahve FincanlarÄ± kÃ¼tahya gÃ¼ral porselen kahve ...

Hediyelikkahvefincanitakimlari.com

Conversion Technology Metas Server

Hediyelikkahvefincanitakimlari.com is hosted in Turkey . Hediyelikkahvefincanitakimlari.com uses HTTPS protocol. Number of used technologies: 2. First technologies: Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Hediyelikkahvefincanitakimlari.com

Technology

Number of occurences: 2

Html
Javascript

Analytics

Number of occurences: 1

Google Analytics

Server Type

Apache

Conversion rate optimization
Clickable call number	Not founded!
Conversion form (contact form, subcriber)	Not founded!
Clickable email	Founded!
CTA (call to action) button	Not founded!
List	Not founded!
Image	Not founded!
Enhancement	Not founded!
Responsive website	Founded!
Facebook sharing	Not founded!
Google+ sharing	Not founded!
Twitter sharing	Not founded!
Linkedin sharing	Not founded!
Blog on the webiste	Not founded!

HTTPS (SSL) - Hediyelikkahvefincanitakimlari.com

SSL certificate

name: /OU=Domain Control Validated/OU=PositiveSSL/CN=yorukoglusut.com.tr
subject:
- OU:
  - 0: Domain Control Validated
  - 1: PositiveSSL
- CN: yorukoglusut.com.tr
hash: 1052fd3a
issuer:
- C: GB
- ST: Greater Manchester
- L: Salford
- O: COMODO CA Limited
- CN: PositiveSSL CA 2
version: 2
serialNumber: 41745004430475098014928732875272050111
validFrom: 140508000000Z
validTo: 150508235959Z
validFrom_time_t: 1399507200
validTo_time_t: 1431129599
extensions:
- authorityKeyIdentifier: keyid:99:E4:40:5F:6B:14:5E:3E:05:D9:DD:D3:63:54:FC:62:B8:F7:00:AC
- subjectKeyIdentifier: 00:2C:3F:CC:86:2E:91:04:88:D9:C5:F9:9A:A9:0C:09:79:8F:DD:E3
- keyUsage: Digital Signature, Key Encipherment
- basicConstraints: CA:FALSE
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: http://www.positivessl.com/CPS Policy: 2.23.140.1.2.1
- crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/PositiveSSLCA2.crl
- authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/PositiveSSLCA2.crt OCSP - URI:http://ocsp.comodoca.com
- subjectAltName: DNS:yorukoglusut.com.tr, DNS:www.yorukoglusut.com.tr

Meta - Hediyelikkahvefincanitakimlari.com

Number of occurences: 6

Name: viewport
Content: width=device-width, initial-scale=1.0
Name: description
Content: hediyelik kahve fincanÄ± takÄ±mlarÄ± kÃ¼tahya gÃ¼ral porselen fincan setleri,Ã§ini kahve takÄ±mÄ± Hediyelik Kahve FincanlarÄ± kÃ¼tahya gÃ¼ral porselen kahve takÄ±mlarÄ± basklÄ± kahve fincanlarÄ±, uygun fiyatlÄ± kahve setleri,kahve kutularÄ±,kadife kutular,ahÅŸap kutular,ucuz kavak kutular Toptan ve perakande ,promosyonluk,promosyon aÃ§amÃ§lÄ± Kahve takÄ±mlarÄ±,KÃ¼tahya Porselen Fincan TakÄ±mÄ± FiyatlarÄ±,promosyon kahve takÄ±mÄ±,porselen Ã§ay takÄ±mlarÄ±,porselen kahve setleri,altÄ±lÄ± kahve takÄ±mÄ±,Ã§iftli kahve takÄ±mÄ±,turkish coffee,ottoman coffe,kahve dunyasÄ±
Name: keywords
Content: hediyelik kahve fincanÄ± takÄ±mlarÄ± kÃ¼tahya gÃ¼ral porselen fincan setleri ,Ã§ini kahve takÄ±mÄ±, kahve fincan takÄ±mlarÄ±,el yapÄ±mÄ± kahve fincan setleri, el iÅŸi kahve fincan takÄ±mlarÄ±, el dekoru kahve fincan takÄ±mlarÄ±, kahve fincanÄ± modelleri, kahve fincanÄ± Ã§eÅŸitleri, kahve fincanÄ± fiyatlarÄ±, kahve fincanÄ± desenleri, kahve fincanÄ± motifleri,kahve fincan fiyat, hediyelik kahve fincanlarÄ± kÃ¼tahya gÃ¼ral porselen kahve takÄ±larÄ±,Geleneksel TÃ¼rk Kahvesi FincanlarÄ±,promosyonluk,ekonomik fiyatlÄ± basklÄ± kahve fincanlarÄ±, uygun fiyatlÄ± kahve setleri,kahve kutularÄ±,kadife kutular,ahÅŸap kutular,ucuz kavak kutular,ucuz fincan setleri,ithal kahve takÄ±mlarÄ±,ithal kave setleriPromosyon amaÃ§lÄ±fincan fiyatlarÄ±,toptan ve perakende satÄ±ÅŸ fiyatÄ±,Promosyon kahve takÄ±mlarÄ±,Turkish Coffee,promasyon fincan setleri,TÃ¼rkischer kaffe KÃ¼tahya porselen kahve takÄ±mÄ± kahve takÄ±mÄ± fincan takÄ±mlarÄ± porselen yemek takÄ±mlarÄ± fincan takÄ±mlarÄ± KÃ¼tahya porselen kahve fincanlarÄ± fincan takÄ±mÄ± kahve fincanÄ± takÄ±mlarÄ± GÃ¼ral Porslen kahve fincanÄ± takÄ±mÄ±, kahve setleri, kahve fincan, kahve fincanlarÄ± , kahve fincan seti , Kahve fincanÄ± , kahve fincanÄ± modelleri kahve fincanÄ± desenleri , kahve fincan resmi , bakir kahve fincanÄ±, gÃ¼ral porselen kahve fincanÄ± ,gÃ¼mÃ¼ÅŸ kahve fincanÄ± , fincan seti ,porselen tepsi ,ikili porselen kahve fincan seti tepsisi ,porselen fincan tepsisi, tepsili kahve seti, tepsili fincan takÄ±mÄ± ,porselen tepsili kahve takÄ±mlarÄ± ,ikili tepsili kahve seti, ikili tepsili fincan seti, altÄ±lÄ± tepsili fincan takÄ±mÄ±, Ã§ay takÄ±mlarÄ± ,fincan takÄ±mlarÄ± ,Ã§ay fincanlarÄ± ,Ã§ay takÄ±mÄ± seti , kÃ¼tahya porselen kahvaltÄ± takÄ±mlarÄ± , Ã§ay seti takÄ±mlarÄ± , porselen Ã§ay takÄ±mlarÄ±, porselen Ã§ay fincanlarÄ±, porselen Ã§ay fincanÄ± takÄ±mlarÄ± ,kahvaltÄ± takÄ±mlarÄ±, porselen kahvaltÄ± takÄ±mlarÄ±, porselen yemek takÄ±mlarÄ±, kÃ¼tahya porselen kahvaltÄ± takÄ±mÄ± ,Geleneksel kahve takÄ±mlarÄ± kahve fincan takÄ±mlarÄ± kahve fincanÄ± takÄ±mlarÄ± kahve fincan takÄ±mÄ± KÃ¼tahya Porselen kahve fincanÄ± kahve fincanÄ± takÄ±mÄ± kahve seti , kahve setleri kahve fincan KÃ¼tahya porselen kahve takÄ±mÄ± kahve takÄ±mÄ± fincan takÄ±mlarÄ± porselen yemek takÄ±mlarÄ± fincan takÄ±mlarÄ± KÃ¼tahya porselen kahve fincanlarÄ± fincan takÄ±mÄ± kahve fincanÄ± takÄ±mlarÄ± GÃ¼ral Porslen kahve fincanÄ± takÄ±mÄ±, kahve setleri, kahve fincan, kahve fincanlarÄ± , kahve fincan seti , Kahve fincanÄ± , kahve fincanÄ± modelleri kahve fincanÄ± desenleri , kahve fincan resmi , bakir kahve fincanÄ±, gÃ¼ral porselen kahve fincanÄ± ,gÃ¼mÃ¼ÅŸ kahve fincanÄ± , fincan seti ,porselen tepsi ,ikili porselen kahve fincan seti tepsisi ,porselen fincan tepsisi, tepsili kahve seti, tepsili fincan takÄ±mÄ± ,porselen tepsili kahve takÄ±mlarÄ± ,ikili tepsili kahve seti, ikili tepsili fincan seti, altÄ±lÄ± tepsili fincan takÄ±mÄ±, Ã§ay takÄ±mlarÄ± ,fincan takÄ±mlarÄ± ,Ã§ay fincanlarÄ± ,Ã§ay takÄ±mÄ± seti , kÃ¼tahya porselen kahvaltÄ± takÄ±mlarÄ± , Ã§ay seti takÄ±mlarÄ± , porselen Ã§ay takÄ±mlarÄ±, porselen Ã§ay fincanlarÄ±, porselen Ã§ay fincanÄ± takÄ±mlarÄ± ,kahvaltÄ± takÄ±mlarÄ±, porselen kahvaltÄ± takÄ±mlarÄ±, porselen yemek takÄ±mlarÄ±, kÃ¼tahya porselen kahvaltÄ± takÄ±mÄ± ,kahve takÄ±mÄ± ve seti,kave takÄ±mlarÄ± ve setleri, kayfe fincanÄ± ve fincanlarÄ±,ince porselen, porselen Ã§ini ve seramik kahve fincan takÄ±mlarÄ±,dekoratif hediyelik el iÅŸi Ã¼rÃ¼nler geleneksel kahve takimlari kahve fincan takÄ±mlarÄ± fincan kahve takÄ±mÄ± seti kutahya porselen kahve fincanÄ± setleri gÃ¼ral porselen kahve fincanÄ± takÄ±mÄ± kahve seti
Name: verify-v1
Content: IFJl5J8kiVdrZQvrSTo2XOhZKJH9/HgPrEaWAOiO+GE=
Name:
Content: text/html; charset=windows-1254
Name: ProgId
Content: FrontPage.Editor.Document

Server / Hosting

IP: 31.7.34.55
Latitude: 38.35
Longitude: 38.32
Country: Turkey

Rname

ns1.elithosting.com
ns3.elithosting.com
ns2.elithosting.com
hediyelikkahvefincanitakimlari.com

Target

sistem.elithosting.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 24 Jul 2016 04:44:42 GMT Server: Apache Last-Modified: Thu, 31 Mar 2016 05:58:07 GMT Accept-Ranges: bytes Content-Length: 54633 Content-Type: text/html X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive